PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA277G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 206aa    MW: 24397.5 Da    PI: 10.0682
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA277G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.21.3e-174821696
                 EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3 16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                 + lpk+f++  g+ k++  ++t+ de+ +sW+vk+ y+k+ +r+ l+kGW+  ++ n+ k gDf+ ++l+++ + ++++++
  AA277G00004  4 INLPKHFTRLSGLTKQC-EEITMSDEHKKSWKVKMAYCKTTDRFRLKKGWRVLCQKNDYKPGDFMKLQLMRN-NNNMFLQI 82
                 679*****888998866.5*************************************************9985.44456555 PP

2B352.31e-16110196386
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                   v+++s +lk +r++lp  f  + +++k+e  ++ l++++g++W+vkl+y     k+ ++y +++GWk+F+++n+  eg ++ ++l++
  AA277G00004 110 MVTVTSESLKDDRVSLPVGFS-KSEIVKRELSEIDLMNKEGKKWKVKLSYvksiVKSIEKYRISRGWKKFCEENHKTEGSSLKLELVK 196
                  56789***************8.6667888888******************9887777788***********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.549186IPR003340B3 DNA binding domain
SMARTSM010195.7E-7186IPR003340B3 DNA binding domain
PfamPF023627.2E-16482IPR003340B3 DNA binding domain
CDDcd100173.58E-14484No hitNo description
Gene3DG3DSA:2.40.330.107.6E-15477IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-14584IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.3E-16105200IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.47E-13107203IPR015300DNA-binding pseudobarrel domain
CDDcd100173.85E-13108201No hitNo description
PROSITE profilePS5086313.676108206IPR003340B3 DNA binding domain
SMARTSM010196.1E-13109205IPR003340B3 DNA binding domain
PfamPF023622.0E-15110199IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MKEINLPKHF TRLSGLTKQC EEITMSDEHK KSWKVKMAYC KTTDRFRLKK GWRVLCQKND  60
YKPGDFMKLQ LMRNNNNMFL QILPFENQIE VESLEAKVEN IEENSSNIFM VTVTSESLKD  120
DRVSLPVGFS KSEIVKRELS EIDLMNKEGK KWKVKLSYVK SIVKSIEKYR ISRGWKKFCE  180
ENHKTEGSSL KLELVKYRTT LLLFMH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G32460.19e-33B3 family protein